PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 749aa    MW: 81597.5 Da    PI: 6.0768
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017150.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS318.11.9e-973897472374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +++L+++Ae +++g+  laq +Larl+++ sp g+p+ R+a+yf+eAL+  l+   +   ++ ++s+ s+ + + ++ a+k fse+sP+++f+++t+N
  Pbr017150.1 389 IDQLFNAAELIETGNPVLAQGILARLNHQLSPIGKPFSRAAFYFKEALQLLLHI-NT---SSNSSSAFSPFSLIFKIGAYKSFSEISPVVQFANFTCN 482
                  689***********************************************9998.22...2334444555559************************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                  qaIleaveg +rvH+iDfdi++G+QW++++q+ a R++g+ sl+iT++ s++++++ e++ t+e+L++fA+el++ fe +++  ++l+    + L ++
  Pbr017150.1 483 QAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALRNGGASSLKITAFISSSAHDEFEVSFTRENLKHFASELNLAFELELVSLESLN-SGSWGLPIH 579
                  **************************************************9*9***************************97444444.447889888 PP

         GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                    + +aV + l + ++ ++++ l+     +L++vk+lsP++vv  ++ +d+++ +F +++++al+ ys l++s++a    + ++ +k+Er ll++ i+
  Pbr017150.1 580 ASDGVAVAVNLPIGSFSSNPLLLPL----ILRFVKQLSPRIVVSLDRGSDRTDVPFPHQIIQALHSYSGLLESIDAV-NVNPDALQKIERYLLQPGIE 672
                  8777777777777788766666666....*********************************************665.34668999************ PP

         GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++v+ ++ +     ++  +Wr  + ++GF+p+++s+++++qa++l++++++ g++ve+++ slvl+W+++ L+s+SaWr
  Pbr017150.1 673 KIVTGRHHS----PKRTPSWRTLFLSSGFSPLTFSNFTESQAECLVQRTPVGGFHVEKRQSSLVLCWQRKDLISASAWR 747
                  ***999888....99999************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.925362727IPR005202Transcription factor GRAS
PfamPF035146.4E-95389747IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MKAMPLPFEE FQGKGVLDFS SVSSSSAAAA ASDSFLSSPP QKWVHRHHSS KENCYVGSTE  60
PTSVLDTRRS PSPPTSSSTL SSSHGSGASG GSTDTTTAAG VENPSQTPLE EQKCGPSLGM  120
EDWESVLSES PGQEQSILRL IMSDIEDPSL GLNTLLQSSS GSDHHHQNLE FGCGGFQDVV  180
DQGGGYGGGF EADDHSGVLV SPSLHASSDP DFNFSNNASN VETQSSNVRP NPTMFSASMS  240
NPFPVSLSSG MFQRQQNMGL EEKPQIFNPQ MVINQNQAQS TQNPAMFMPL TYAQLQEHHL  300
LSPPPSKRLN SGGFGPGYPV QRVPFLNPGQ ELLVRAQQQQ QQLQFLPQHL QQQRPTMPVA  360
KEKMMSPAEG GKEMMNQNHQ QQQLQQAVID QLFNAAELIE TGNPVLAQGI LARLNHQLSP  420
IGKPFSRAAF YFKEALQLLL HINTSSNSSS AFSPFSLIFK IGAYKSFSEI SPVVQFANFT  480
CNQAILEAVE GFNRVHVIDF DIGYGGQWAS FMQEVALRNG GASSLKITAF ISSSAHDEFE  540
VSFTRENLKH FASELNLAFE LELVSLESLN SGSWGLPIHA SDGVAVAVNL PIGSFSSNPL  600
LLPLILRFVK QLSPRIVVSL DRGSDRTDVP FPHQIIQALH SYSGLLESID AVNVNPDALQ  660
KIERYLLQPG IEKIVTGRHH SPKRTPSWRT LFLSSGFSPL TFSNFTESQA ECLVQRTPVG  720
GFHVEKRQSS LVLCWQRKDL ISASAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3040374718375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009374164.10.0PREDICTED: scarecrow-like protein 27
TrEMBLM5X7H70.0M5X7H7_PRUPE; Uncharacterized protein
STRINGGLYMA11G17490.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-133GRAS family protein